Predictions User input Your e-mail address Job Title Paste a list query ID pairs Q:P Paste query protein sequences in fasta format >Q VNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE >P VHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSP Paste the deletion file (optional) Click here for file format Q:P => 1m9xE:1m9xC,1m9eB:1m9eC,2x2dB:2x2dE Interface residue definition CA-CA (Alpha carbon-Alpha carbon) distance Threshold Å Algorithm parameters Zone parameters Safe Zone cutoff Twilight Zone 1 cutoff Twilight Zone 2 cutoff Twilight Zone 3 cutoff Dark Zone cutoff HHpred parameters Number of iternation when searching against UniProt Number of iternation when searching against PDB E-value cutoff for Uniprot search E-value cutoff for PDB search min coverarge with query (%) (the -cov option of hhpred) for PDB search max sequence identity (the -id option of hhpred) for PDB search (for less redundancy) min hhpred probability cutoff for PDB search minimal residue number in alignment
